Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fads3 Rabbit Polyclonal Antibody (FITC)

Fads3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8K1P9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fads3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DISRWAQRHPGGSRLIGHHSAEDATDAFHAFHQDLHFVRKFLKPLLIGEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tmem33 shRNA (UAS) - Lentiviral mouse Tmem33 shRNA (UAS, GFP) plasmid
GTR15171334 1 Vial

Lentiviral mouse Tmem33 shRNA (UAS) - Lentiviral mouse Tmem33 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Olfr147 Double Nickase Plasmid (m)
sc-434970-NIC 20 µg

Olfr147 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)
MBS2059655-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)
MBS2059655-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)
MBS2059655-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)
MBS2059655-04 1 mL

Cy3-Linked Polyclonal Antibody to Hedgehog Homolog, Sonic (SHH)

Sign In for Pricing
View Details