Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR Rabbit Polyclonal Antibody (Biotin)

SIGIRR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TIR8, IL-1R8

UniProt

Q6IA17

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SIGIRR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 550)
244505-ML550 100 µL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 550)

Sign In for Pricing
View Details
HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) (MaxLight 405)
MBS6420308-01 0.1 mL

HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) (MaxLight 405)

Sign In for Pricing
View Details
HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) (MaxLight 405)
MBS6420308-02 5x 0.1 mL

HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) (MaxLight 405)

Sign In for Pricing
View Details
KYNU (Kynureninase, L-kynurenine Hydrolase) (MaxLight 405) discontinued
128975-ML405 100 µL

KYNU (Kynureninase, L-kynurenine Hydrolase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
UAP1 (SPAG2, UDP-N-acetylhexosamine Pyrophosphorylase, Antigen X, Sperm-associated Antigen 2, UDP-N-acetylgalactosamine Pyrophosphorylase, AGX-1, UDP-N-acetylglucosamine Pyrophosphorylase, AGX-2) (MaxLight 490)
134970-ML490 100 µL

UAP1 (SPAG2, UDP-N-acetylhexosamine Pyrophosphorylase, Antigen X, Sperm-associated Antigen 2, UDP-N-acetylgalactosamine Pyrophosphorylase, AGX-1, UDP-N-acetylglucosamine Pyrophosphorylase, AGX-2) (MaxLight 490)

Sign In for Pricing
View Details
[2- (2-Methylmorpholin-4-yl) pyridin-4-yl]methanamine
DNB90177-01 50 mg

[2- (2-Methylmorpholin-4-yl) pyridin-4-yl]methanamine

Sign In for Pricing
View Details