Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3A Rabbit Polyclonal Antibody (Biotin)

FAM3A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DLD, 2.19, XAP-7, DXS560S

UniProt

P98173

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FAM3A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001164603.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr46 (NM_146934) Mouse Tagged ORF Clone Lentiviral Particle
MR213639L4V 200 µL

Olfr46 (NM_146934) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)
MBS6152846-01 0.1 mL

HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)

Sign In for Pricing
View Details
HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)
MBS6152846-02 5x 0.1 mL

HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)

Sign In for Pricing
View Details
Horse cluster Of differentiation 4, CD4 GENLISA ELISA
KLV0081 96 Well

Horse cluster Of differentiation 4, CD4 GENLISA ELISA

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]
TA505631AM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]

Sign In for Pricing
View Details
Cytokeratin 13 Antibody
orb2644868 100 µg

Cytokeratin 13 Antibody

Sign In for Pricing
View Details