Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam3a Rabbit Polyclonal Antibody (HRP)

Fam3a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562076

UniProt

B5DFJ2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fam3a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102794

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI6 (NM_022873) Human Tagged ORF Clone Lentiviral Particle
RC213048L4V 200 µL

IFI6 (NM_022873) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tubulin, alpha (BSA & Azide Free) (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (MaxLight 550)
MBS6267600-01 0.1 mL

Tubulin, alpha (BSA & Azide Free) (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (MaxLight 550)

Sign In for Pricing
View Details
Tubulin, alpha (BSA & Azide Free) (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (MaxLight 550)
MBS6267600-02 5x 0.1 mL

Tubulin, alpha (BSA & Azide Free) (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Phldb2 activation kit by CRISPRa
GA212852 1 Kit

Mouse Phldb2 activation kit by CRISPRa

Sign In for Pricing
View Details
TSHB Rabbit pAb
E47R2676 100 µL

TSHB Rabbit pAb

Sign In for Pricing
View Details
RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive), DELXp11.3, KIAA0215, TBCCD2) (MaxLight 550)
MBS6219031-01 0.1 mL

RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive), DELXp11.3, KIAA0215, TBCCD2) (MaxLight 550)

Sign In for Pricing
View Details