Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL5 Rabbit Polyclonal Antibody (Biotin)

ELOVL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HELO1, SCA38, dJ483K16.1

UniProt

Q9NYP7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3/3166R), CF640R conjugate, 0.1mg/mL
BNC403166-100 1x 100 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3/3166R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF488A conjugate, 0.1mg/mL
BNC881774-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL
BNC742316-500 1x 500 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RED1 (ADARB1) (NM_015833) Human Recombinant Protein
TP312324M 100 µg

RED1 (ADARB1) (NM_015833) Human Recombinant Protein

Sign In for Pricing
View Details
OR1K1 Human qPCR Primer Pair (NM_080859)
HP216771 200 Reactions

OR1K1 Human qPCR Primer Pair (NM_080859)

Sign In for Pricing
View Details
Mouse Lptn/XCL1 Antibody Pair Set
E-KAB-0714 50 µL & 100 µg

Mouse Lptn/XCL1 Antibody Pair Set

Sign In for Pricing
View Details