Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL5 Rabbit Polyclonal Antibody (Biotin)

ELOVL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HELO1, SCA38, dJ483K16.1

UniProt

Q9NYP7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVK (NM_001114185) Human Recombinant Protein
TP325616M 100 µg

MVK (NM_001114185) Human Recombinant Protein

Sign In for Pricing
View Details
SETD4 (NM_001007259) Human Over-expression Lysate
LY423476 100 µg

SETD4 (NM_001007259) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]
ET1611-71 100 µL

Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF740 conjugate, 0.1mg/mL
BNC740631-500 1x 500 µL

Human Lambda Light Chain (LcN-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TACC1 activation kit by CRISPRa
GA104726 1 Kit

Human TACC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human TFPI Protein (His Tag)
PKSH031525-01 50 µg

Recombinant Human TFPI Protein (His Tag)

Sign In for Pricing
View Details