Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL5 Rabbit Polyclonal Antibody (HRP)

ELOVL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HELO1, SCA38, dJ483K16.1

UniProt

Q9NYP7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CX028 Rabbit Polyclonal Antibody
BT-AP02050-01 20 µL

CX028 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CX028 Rabbit Polyclonal Antibody
BT-AP02050-02 50 µL

CX028 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CX028 Rabbit Polyclonal Antibody
BT-AP02050-03 100 µL

CX028 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal THYN1 Antibody
NBP2-98501-50ul 50 µL

Rabbit Polyclonal THYN1 Antibody

Sign In for Pricing
View Details
Anti-Hu CD172ab Purified
MBS1801525-01 0.1 mg

Anti-Hu CD172ab Purified

Sign In for Pricing
View Details
Anti-Hu CD172ab Purified
MBS1801525-02 5x 0.1 mg

Anti-Hu CD172ab Purified

Sign In for Pricing
View Details