Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A23 Rabbit Polyclonal Antibody (HRP)

SLC22A23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf85

UniProt

A1A5C7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC22A23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DNA Ligase I Antibody [HRP]
NBP2-97831H 0.1 mL

Rabbit Polyclonal DNA Ligase I Antibody [HRP]

Sign In for Pricing
View Details
Human Reg3Γ (Regenerating Islet Derived Protein 3 Gamma) ELISA Kit
FY-EH2667 96 Well

Human Reg3Γ (Regenerating Islet Derived Protein 3 Gamma) ELISA Kit

Sign In for Pricing
View Details
Mouse CD81 (CD81) ELISA Kit
YP-W28724-01 48 Tests

Mouse CD81 (CD81) ELISA Kit

Sign In for Pricing
View Details
Mouse CD81 (CD81) ELISA Kit
YP-W28724-02 96 Tests

Mouse CD81 (CD81) ELISA Kit

Sign In for Pricing
View Details
Anti Trazodone Pab Rat
150280 100 µg

Anti Trazodone Pab Rat

Sign In for Pricing
View Details
KHNYN Protein Vector (Mouse) (pPM-C-His)
PV194161 500 ng

KHNYN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details