Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIEZO2 Rabbit Polyclonal Antibody (HRP)

PIEZO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DA3, DA5, MWKS, DAIPT, FAM38B, HsT748, HsT771, FAM38B2, C18orf30, C18orf58

UniProt

Q9H5I5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PIEZO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GLT8D2 shRNA (UAS) - Lentiviral human GLT8D2 shRNA (UAS, iRFP) (100)
GTR15162423 1 Vial

Lentiviral human GLT8D2 shRNA (UAS) - Lentiviral human GLT8D2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
LIN28 inhibitor LI71
B3073-25 25 mg

LIN28 inhibitor LI71

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)
MBS1483329-01 0.02 mg (E-Coli)

Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)
MBS1483329-02 0.1 mg (E-Coli)

Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)
MBS1483329-03 0.02 mg (Yeast)

Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)
MBS1483329-04 0.1 mg (Yeast)

Recombinant Listeria innocua serovar 6a UPF0309 protein lin2794 (lin2794)

Sign In for Pricing
View Details