Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM38B Rabbit Polyclonal Antibody (HRP)

FAM38B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DA3, DA5, MWKS, DAIPT, FAM38B, HsT748, HsT771, FAM38B2, C18orf30, C18orf58

UniProt

Q9H5I5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM38B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptavidin Cy5.5 Conjugated
B2024824 1 mg

Streptavidin Cy5.5 Conjugated

Sign In for Pricing
View Details
Human SMG1P5 qPCR Primer Pair
QH80117S 200 Tests

Human SMG1P5 qPCR Primer Pair

Sign In for Pricing
View Details
GYLTL1B sgRNA CRISPR Lentivector (Human) (Target 1)
K0923002 1.0 µg DNA

GYLTL1B sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis Bifunctional protein FolD 1 (folD1)
MBS1304482-01 0.02 mg (E-Coli)

Recombinant Bordetella parapertussis Bifunctional protein FolD 1 (folD1)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis Bifunctional protein FolD 1 (folD1)
MBS1304482-02 0.02 mg (Yeast)

Recombinant Bordetella parapertussis Bifunctional protein FolD 1 (folD1)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis Bifunctional protein FolD 1 (folD1)
MBS1304482-03 0.1 mg (E-Coli)

Recombinant Bordetella parapertussis Bifunctional protein FolD 1 (folD1)

Sign In for Pricing
View Details