Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Marapsin/Pancreasin, Human (HEK293, His)

Marapsin/pancreatin protein shows predominant expression in the pancreas, emphasizing its central role in pancreatic tissue. As a key member within this organ, marapsin/pancreatin may play a crucial role in pancreatic function and processes. Marapsin/Pancreasin Protein, Human (HEK293, His) is the recombinant human-derived Marapsin/Pancreasin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Marapsin/Pancreasin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/marapsin-pancreasin-protein-human-hek293-his.html

Purity

96.0

Smiles

ATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARLGGQK

Molecular Formula

83886 (Gene_ID) Q9BQR3 (A23-K290) (Accession)

Molecular Weight

Approximately 35-45 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4 Rabbit pAb, PerCP-Cy7 conjugated
orb2881422 100 µL

MAP4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
CSNK1E (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (MaxLight 650)
MBS6221662-01 0.1 mL

CSNK1E (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (MaxLight 650)

Sign In for Pricing
View Details
CSNK1E (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (MaxLight 650)
MBS6221662-02 5x 0.1 mL

CSNK1E (Casein Kinase I, epsilon Isoform, CKI-epsilon, CKIe) (MaxLight 650)

Sign In for Pricing
View Details
Vascuolar Cell Adhesion Molecule 1 (VCAM-1) Human ELISA Kit
95911 96 Tests

Vascuolar Cell Adhesion Molecule 1 (VCAM-1) Human ELISA Kit

Sign In for Pricing
View Details
ADP Ribosylation Factor 6 (ARF6) discontinued
A0902-01 500 µL

ADP Ribosylation Factor 6 (ARF6) discontinued

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)
MBS2167456-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)

Sign In for Pricing
View Details