Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIR Rabbit Polyclonal Antibody (FITC)

VSIR Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B7H5, GI24, B7-H5, Dies1, PD-1H, SISP1, VISTA, PP2135, C10orf54, DD1alpha

UniProt

Q9H7M9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf54

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_071436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 Rabbit Polyclonal Antibody (BF350)
orb1573738 100 µL

XRCC3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Lentiviral mouse Rpl29 shRNA (UAS) - Lentiviral mouse Rpl29 shRNA (UAS, iRFP) (100)
GTR15226455 1 Vial

Lentiviral mouse Rpl29 shRNA (UAS) - Lentiviral mouse Rpl29 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-Zebrafish DLST Antibody Picoband® Fluoro488 Conjugated
AZQ7ZVL3-Fluoro488 100 µg/Vial

Anti-Zebrafish DLST Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Anti-Phospho-ER alpha (Thr311) Polyclonal Antibody
TMAC-01394-01 50 μL

Anti-Phospho-ER alpha (Thr311) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ER alpha (Thr311) Polyclonal Antibody
TMAC-01394-02 100 µL

Anti-Phospho-ER alpha (Thr311) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Zfp110 shRNA (UAS) - Lentiviral mouse Zfp110 shRNA (UAS, iRFP) plasmid
GTR15239140 1 Vial

Lentiviral mouse Zfp110 shRNA (UAS) - Lentiviral mouse Zfp110 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details