Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIR Rabbit Polyclonal Antibody (HRP)

VSIR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B7H5, GI24, B7-H5, Dies1, PD-1H, SISP1, VISTA, PP2135, C10orf54, DD1alpha

UniProt

Q9H7M9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_071436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PU.1 Lentiviral Activation Particles (h2)
sc-400547-LAC-2 200 µL

PU.1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RITA Polyclonal Antibody, Cy3 Conjugated
bs-11945R-Cy3 100 µL

RITA Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Mouse DNA Mismatch Repair Protein Msh3 (MSH3) ELISA Kit
RD-MSH3-Mu-01 48 Tests

Mouse DNA Mismatch Repair Protein Msh3 (MSH3) ELISA Kit

Sign In for Pricing
View Details
Mouse DNA Mismatch Repair Protein Msh3 (MSH3) ELISA Kit
RD-MSH3-Mu-02 96 Tests

Mouse DNA Mismatch Repair Protein Msh3 (MSH3) ELISA Kit

Sign In for Pricing
View Details
Gm13306 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4323706 1.0 µg DNA

Gm13306 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
pCMV-Flag-IRF7 Plasmid
PVTB00308-2a 2 µg

pCMV-Flag-IRF7 Plasmid

Sign In for Pricing
View Details