Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMP1, Human (P.pastoris, His)

CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CEMP1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cemp1-protein-human-p-pastoris-his.html

Smiles

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Molecular Formula

752014 (Gene_ID) Q6PRD7 (M1-G247) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-L-Lys-Amc Acetic Acid Salt (~90%)
TRC-B643110-250MG 250 mg

Boc-L-Lys-Amc Acetic Acid Salt (~90%)

Sign In for Pricing
View Details
ASB9 (NM_001031739) Human Over-expression Lysate
LY422184 100 µg

ASB9 (NM_001031739) Human Over-expression Lysate

Sign In for Pricing
View Details
TST (NM_003312) Human Recombinant Protein
TP304002L 1 mg

TST (NM_003312) Human Recombinant Protein

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-01 20 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-02 60 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-03 120 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details