Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMP1, Human (P.pastoris, His)

CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CEMP1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cemp1-protein-human-p-pastoris-his.html

Smiles

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Molecular Formula

752014 (Gene_ID) Q6PRD7 (M1-G247) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxysulfapyridine
TRC-H954010-25MG 25 mg

5-Hydroxysulfapyridine

Sign In for Pricing
View Details
Mouse TNFRSF1B Antibody Pair Set
E-KAB-0296 50 µL & 100 µg

Mouse TNFRSF1B Antibody Pair Set

Sign In for Pricing
View Details
Human MCP-4 Antibody Pair Set
E-KAB-0726 50 µL & 100 µg

Human MCP-4 Antibody Pair Set

Sign In for Pricing
View Details
Secretogranin 3 (SCG3) (NM_013243) Human Over-expression Lysate
LY402232 100 µg

Secretogranin 3 (SCG3) (NM_013243) Human Over-expression Lysate

Sign In for Pricing
View Details
LOC643802 (NM_001207030) Human Tagged ORF Clone
RG236081 10 µg

LOC643802 (NM_001207030) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human KLHL20 activation kit by CRISPRa
GA109087 1 Kit

Human KLHL20 activation kit by CRISPRa

Sign In for Pricing
View Details