Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POPDC3 Rabbit Polyclonal Antibody (Biotin)

POPDC3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

POP3, LGMDR26, bA355M14.1

UniProt

Q9HBV1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human POPDC3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCL1, CT (Class A Basic Helix-loop-helix Protein 46, Achaete-scute Homolog 1, ASH-1, hASH1, bHLHa46, ASH1, BHLHA46, HASH1) (Biotin) discontinued
A3619-80B-Biotin 200 µL

ASCL1, CT (Class A Basic Helix-loop-helix Protein 46, Achaete-scute Homolog 1, ASH-1, hASH1, bHLHa46, ASH1, BHLHA46, HASH1) (Biotin) discontinued

Sign In for Pricing
View Details
Human Cryptosporidium Fecal ELISA Kit
NR-R10180-01 1 Each

Human Cryptosporidium Fecal ELISA Kit

Sign In for Pricing
View Details
Human Cryptosporidium Fecal ELISA Kit
NR-R10180-02 1 Each

Human Cryptosporidium Fecal ELISA Kit

Sign In for Pricing
View Details
Caspase-6 (CASP-6, Apoptotic protease Mch-2, CASP6, MCH2) (MaxLight 405) discontinued
124363-ML405 100 µL

Caspase-6 (CASP-6, Apoptotic protease Mch-2, CASP6, MCH2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Adenosine Receptor A1 (ADORA1) Chicken ELISA Kit
B2808 96 Tests

Adenosine Receptor A1 (ADORA1) Chicken ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Cnnm4 shRNA (UAS) - Lentiviral mouse Cnnm4 shRNA (UAS, RFP) (25)
GTR15210683 1 Vial

Lentiviral mouse Cnnm4 shRNA (UAS) - Lentiviral mouse Cnnm4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details