Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atl2 Rabbit Polyclonal Antibody (FITC)

Atl2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ai, Ar, Aip-2, Arl6ip2, AA407293, AV334690, 2010110I21Rik

UniProt

E9QND8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_835151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem146 3'UTR Lenti-reporter-Luc Vector
46903084 1.0 µg

Tmem146 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Kank4 (NM_172872) Mouse Tagged Lenti ORF Clone
MR211454L3 10 µg

Kank4 (NM_172872) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tyk2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3777006 1.0 µg DNA

Tyk2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Op18 (phospho Ser38) Polyclonal Antibody
E44H00763 100 µL

Op18 (phospho Ser38) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Migration and invasion-inhibitory protein (Miip)
MBS1235800-01 0.02 mg (E-Coli)

Recombinant Mouse Migration and invasion-inhibitory protein (Miip)

Sign In for Pricing
View Details
Recombinant Mouse Migration and invasion-inhibitory protein (Miip)
MBS1235800-02 0.02 mg (Yeast)

Recombinant Mouse Migration and invasion-inhibitory protein (Miip)

Sign In for Pricing
View Details