Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atl2 Rabbit Polyclonal Antibody (HRP)

Atl2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ai, Ar, Aip-2, Arl6ip2, AA407293, AV334690, 2010110I21Rik

UniProt

E9QND8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_835151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAGC Antibody
8C18213-AAT 50 µg

RRAGC Antibody

Sign In for Pricing
View Details
Histone H1 (HH1/957), 1mg/mL
BNUM0957-50 1x 50 µL

Histone H1 (HH1/957), 1mg/mL

Sign In for Pricing
View Details
Human CRBN activation kit by CRISPRa
GA109633 1 Kit

Human CRBN activation kit by CRISPRa

Sign In for Pricing
View Details
ATP5O Polyclonal Antibody
E-AB-53090-01 20 µL

ATP5O Polyclonal Antibody

Sign In for Pricing
View Details
ATP5O Polyclonal Antibody
E-AB-53090-02 60 µL

ATP5O Polyclonal Antibody

Sign In for Pricing
View Details
ATP5O Polyclonal Antibody
E-AB-53090-03 120 µL

ATP5O Polyclonal Antibody

Sign In for Pricing
View Details