Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBDF1 Rabbit Polyclonal Antibody (HRP)

RHBDF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dist1, hDist1, C16orf8, EGFR-RS, gene-89, gene-90

UniProt

Q96CC6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071895

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS513172 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
THAP7 (NM_001008695) Human Over-expression Lysate
LC423347 20 µg

THAP7 (NM_001008695) Human Over-expression Lysate

Sign In for Pricing
View Details
Culture Tubes
T8225 1000 Units/Case

Culture Tubes

Sign In for Pricing
View Details
cIAP2 (BIRC3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]
TA800041AM 100 µL

cIAP2 (BIRC3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
LOC105369243 (Center) Rabbit Polyclonal Antibody
AP54101PU-N 400 µL

LOC105369243 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]
TA802407BM 100 µL

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details