Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH24 Rabbit Polyclonal Antibody (FITC)

CDH24 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDH11L

UniProt

Q86UP0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDH24

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSBP2 Human siRNA Oligo Duplex (Locus ID 23635)
SR308417 1 Kit

SSBP2 Human siRNA Oligo Duplex (Locus ID 23635)

Sign In for Pricing
View Details
RXRα/β/γ (F-1) Alexa Fluor® 790
sc-46659 AF790 200 µg/mL

RXRα/β/γ (F-1) Alexa Fluor® 790

Sign In for Pricing
View Details
Olr1697 Protein Lysate (Rat) with C-HA Tag
34148036 100 µg

Olr1697 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 Antibody (MT264)
NBP3-18283-1000ug 1000 µg

Mouse Monoclonal IL-2 Antibody (MT264)

Sign In for Pricing
View Details
SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) APC
MBS6138936-01 0.1 mL

SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) APC

Sign In for Pricing
View Details
SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) APC
MBS6138936-02 5x 0.1 mL

SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) APC

Sign In for Pricing
View Details