Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNDC3B Rabbit Polyclonal Antibody (Biotin)

FNDC3B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAD104, PRO4979, YVTM2421

UniProt

Q53EP0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FNDC3B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW78473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MKNK1 (T255) Antibody
A42265-50UG 50 µg

Phospho-MKNK1 (T255) Antibody

Sign In for Pricing
View Details
Mgst1 Mouse Gene Knockout Kit (CRISPR)
KN510071 1 Kit

Mgst1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat succinyl coenzyme A synase (SCS) ELISA Kit
YP-W37325-01 48 Tests

Rat succinyl coenzyme A synase (SCS) ELISA Kit

Sign In for Pricing
View Details
Rat succinyl coenzyme A synase (SCS) ELISA Kit
YP-W37325-02 96 Tests

Rat succinyl coenzyme A synase (SCS) ELISA Kit

Sign In for Pricing
View Details
Phospho-Smad5-S463/465 Rabbit mAb (AMR12233N)
AMR12233N-01 50 µL

Phospho-Smad5-S463/465 Rabbit mAb (AMR12233N)

Sign In for Pricing
View Details
Phospho-Smad5-S463/465 Rabbit mAb (AMR12233N)
AMR12233N-02 100 µL

Phospho-Smad5-S463/465 Rabbit mAb (AMR12233N)

Sign In for Pricing
View Details