Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMF1 Rabbit Polyclonal Antibody (HRP)

LMF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JFP11, TMEM112, C16orf26, HMFN1876, TMEM112A

UniProt

H3BVI4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human LMF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

XP_011520919.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCF Recombinant Rabbit Monoclonal Antibody [SC61-06]
ET1610-77 100 µL

SCF Recombinant Rabbit Monoclonal Antibody [SC61-06]

Sign In for Pricing
View Details
CD105 (ENG) Mouse Monoclonal Antibody [Clone ID: MEM-229]
AM03092PU-N 100 µg

CD105 (ENG) Mouse Monoclonal Antibody [Clone ID: MEM-229]

Sign In for Pricing
View Details
DENND2D Human Gene Knockout Kit (CRISPR)
KN402653 1 Kit

DENND2D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707567 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IFluor® 555 goat anti-rabbit IgG (H+L)
16620-AAT 200 µg

IFluor® 555 goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
Diisobutyl Phthalate
TRC-D455210-1G 1 g

Diisobutyl Phthalate

Sign In for Pricing
View Details