Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL1 Rabbit Polyclonal Antibody (HRP)

ELOVL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ssc1, IKSHD, CGI-88

UniProt

Q9BW60

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELOV1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMV

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shisa4 siRNA Oligos set (Rat)
43717176 3x 5 nmol

Shisa4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Pigeon Gastrokine 1 ELISA Kit
MBS049143 Inquire

Pigeon Gastrokine 1 ELISA Kit

Sign In for Pricing
View Details
Keratin, pan multiple clones (BSA & Azide Free) (MaxLight 490) discontinued
K0199-91X-ML490 100 µL

Keratin, pan multiple clones (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details
WNT2B Antibody - N-terminal region : HRP (ARP41275_P050-HRP)
ARP41275_P050-HRP 100 µL

WNT2B Antibody - N-terminal region : HRP (ARP41275_P050-HRP)

Sign In for Pricing
View Details
4-Bromo-2- (5-isoxazolyl) phenol
266414-01 5 g

4-Bromo-2- (5-isoxazolyl) phenol

Sign In for Pricing
View Details
4-Bromo-2- (5-isoxazolyl) phenol
266414-02 10 g

4-Bromo-2- (5-isoxazolyl) phenol

Sign In for Pricing
View Details