Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcn Rabbit Polyclonal Antibody (HRP)

Porcn Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P, Mp, Ppn, Mg61, porc, Mporc, mMg61, AW045557, DXHXS7465, DXHXS7465e, 2410004O13Rik

UniProt

Q9JJJ7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058609

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-H4 Antibody Blocking Peptide
orb72371 500 µg

B7-H4 Antibody Blocking Peptide

Sign In for Pricing
View Details
MEGF6 Human Gene Knockout Kit (CRISPR)
KN413157 1 Kit

MEGF6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ChT ELISA Kit
orb548813-01 48 Tests

Human ChT ELISA Kit

Sign In for Pricing
View Details
Human ChT ELISA Kit
orb548813-02 96 Tests

Human ChT ELISA Kit

Sign In for Pricing
View Details
Human Vascular Endothelial Growth Factor C (VEGF-C) ELISA Kit
orb2812358-01 48 Tests

Human Vascular Endothelial Growth Factor C (VEGF-C) ELISA Kit

Sign In for Pricing
View Details
Human Vascular Endothelial Growth Factor C (VEGF-C) ELISA Kit
orb2812358-02 96 Tests

Human Vascular Endothelial Growth Factor C (VEGF-C) ELISA Kit

Sign In for Pricing
View Details