Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASD1 Rabbit Polyclonal Antibody (HRP)

CASD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOAT, C7orf12, NBLA04196

UniProt

Q96PB1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CASD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_075051

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yeast lepB protein
orb246849-01 20 µg

Yeast lepB protein

Sign In for Pricing
View Details
Yeast lepB protein
orb246849-02 100 µg

Yeast lepB protein

Sign In for Pricing
View Details
Yeast lepB protein
orb246849-03 1 mg

Yeast lepB protein

Sign In for Pricing
View Details
DDO (D-Aspartate Oxidase)
479155 100 µL

DDO (D-Aspartate Oxidase)

Sign In for Pricing
View Details
SNRNP200 (Small Nuclear Ribonucleoprotein 200kD, BRR2, RP33, HELIC2, ASCC3L1, U5-200KD) (PE)
MBS6438452-01 0.1 mL

SNRNP200 (Small Nuclear Ribonucleoprotein 200kD, BRR2, RP33, HELIC2, ASCC3L1, U5-200KD) (PE)

Sign In for Pricing
View Details
SNRNP200 (Small Nuclear Ribonucleoprotein 200kD, BRR2, RP33, HELIC2, ASCC3L1, U5-200KD) (PE)
MBS6438452-02 5x 0.1 mL

SNRNP200 (Small Nuclear Ribonucleoprotein 200kD, BRR2, RP33, HELIC2, ASCC3L1, U5-200KD) (PE)

Sign In for Pricing
View Details