Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrc19 Rabbit Polyclonal Antibody (HRP)

Lrrc19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI314124, AL022954, AW261791, 9130022A01Rik

UniProt

Q8BZT5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Lrrc19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTWTSEHEPLGKSWAFLVGVVATVLLTSLLIFIAIKCPVWYNILLSYNHH

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_780514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hipk1 activation kit by CRISPRa
GA201901 1 Kit

Mouse Hipk1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human RNA Binding Motif Protein 24 (RBM24) CLIA Kit
abx496214-01 96 Tests

Human RNA Binding Motif Protein 24 (RBM24) CLIA Kit

Sign In for Pricing
View Details
Human RNA Binding Motif Protein 24 (RBM24) CLIA Kit
abx496214-02 5x 96 Tests

Human RNA Binding Motif Protein 24 (RBM24) CLIA Kit

Sign In for Pricing
View Details
Human RNA Binding Motif Protein 24 (RBM24) CLIA Kit
abx496214-03 10x 96 Tests

Human RNA Binding Motif Protein 24 (RBM24) CLIA Kit

Sign In for Pricing
View Details
TNF siRNA (Mouse)
MBS8201527-01 15 nmol

TNF siRNA (Mouse)

Sign In for Pricing
View Details
TNF siRNA (Mouse)
MBS8201527-02 30 nmol

TNF siRNA (Mouse)

Sign In for Pricing
View Details