Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP1 Rabbit Polyclonal Antibody (HRP)

REEP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HMN5B, SPG31, Yip2a, C2orf23

UniProt

Q9H902

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human REEP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAK3 (NAA30) (NM_001011713) Human Over-expression Lysate
LS122830-20ug 20 µg

MAK3 (NAA30) (NM_001011713) Human Over-expression Lysate

Sign In for Pricing
View Details
DNAJB5 (NM_012266) Human Tagged ORF Clone Lentiviral Particle
RC222132L4V 200 µL

DNAJB5 (NM_012266) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VENTXP3 3'UTR Luciferase Stable Cell Line
TU028103 1.0 mL

VENTXP3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CHCHD1 (NM_203298) Human Tagged ORF Clone
RG204571 10 µg

CHCHD1 (NM_203298) Human Tagged ORF Clone

Sign In for Pricing
View Details
CCT sgRNA CRISPR Lentivector (Human) (Target 1)
K0396302 1.0 µg DNA

CCT sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LARP1B Protein Vector (Rat) (pPM-C-His)
PV277105 500 ng

LARP1B Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details