Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP1 Rabbit Polyclonal Antibody (Biotin)

REEP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMN5B, SPG31, Yip2a, C2orf23

UniProt

Q9H902

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human REEP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wipf1 (NM_057192) Rat Tagged Lenti ORF Clone
RR212461L4 10 µg

Wipf1 (NM_057192) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lead (II) Iodide 99%
GPC19881-2W 50 g

Lead (II) Iodide 99%

Sign In for Pricing
View Details
PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (MaxLight 405)
MBS6191853-01 0.1 mL

PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (MaxLight 405)

Sign In for Pricing
View Details
PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (MaxLight 405)
MBS6191853-02 5x 0.1 mL

PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (MaxLight 405)

Sign In for Pricing
View Details
FLT3 Protein Vector (Rat) (pPB-N-His)
PV268735 500 ng

FLT3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
GUSB, CT (GUSB, Beta-glucuronidase, Beta-G1) (Azide free) (HRP) discontinued
036391-HRP 200 µL

GUSB, CT (GUSB, Beta-glucuronidase, Beta-G1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details