Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acsl4 Rabbit Polyclonal Antibody (HRP)

Acsl4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AC, La, Fac, ACS4, Facl4, Lacs4, AU018108, 9430020A05Rik

UniProt

Q9QUJ7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Acsl4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997508

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serine Peptidase Inhibitor Kazal Type 5 (SPINK5) Mouse ELISA Kit
G9707 96 Tests

Serine Peptidase Inhibitor Kazal Type 5 (SPINK5) Mouse ELISA Kit

Sign In for Pricing
View Details
ITGB1BP3 Rabbit Polyclonal Antibody (Biotin)
orb2121760 100 µL

ITGB1BP3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MT3 (NM_005954) Human Tagged ORF Clone Lentiviral Particle
RC203753L3V 200 µL

MT3 (NM_005954) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2-{5H,6H,7H,8H-[1,2,4]Triazolo[4,3-a]pyrazin-3-yl}pyridine dihydrochloride
NDC37574-01 50 mg

2-{5H,6H,7H,8H-[1,2,4]Triazolo[4,3-a]pyrazin-3-yl}pyridine dihydrochloride

Sign In for Pricing
View Details
2-{5H,6H,7H,8H-[1,2,4]Triazolo[4,3-a]pyrazin-3-yl}pyridine dihydrochloride
NDC37574-02 0.5 g

2-{5H,6H,7H,8H-[1,2,4]Triazolo[4,3-a]pyrazin-3-yl}pyridine dihydrochloride

Sign In for Pricing
View Details
9H-Fluorene, 2,2'- (diphenylsilylene) bis[9,9-dimethyl-
1208005-83-7 1 Each

9H-Fluorene, 2,2'- (diphenylsilylene) bis[9,9-dimethyl-

Sign In for Pricing
View Details