Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPE1 Rabbit Polyclonal Antibody (Biotin)

MPPE1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cdc1, PGAP5

UniProt

Q53F39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MPPE1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLOC1S6 (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA, PLDN)
406143-01 50 µL

BLOC1S6 (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA, PLDN)

Sign In for Pricing
View Details
BLOC1S6 (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA, PLDN)
406143-02 100 µL

BLOC1S6 (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA, PLDN)

Sign In for Pricing
View Details
Txndc15 3'UTR Luciferase Stable Cell Line
TU121398 1.0 mL

Txndc15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) (MaxLight 550)
MBS6254755-01 0.1 mL

CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) (MaxLight 550)

Sign In for Pricing
View Details
CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) (MaxLight 550)
MBS6254755-02 5x 0.1 mL

CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) (MaxLight 550)

Sign In for Pricing
View Details
CBR3, CT (CBR3, Carbonyl reductase [NADPH] 3, NADPH-dependent carbonyl reductase 3) (AP) discontinued
033244-AP 200 µL

CBR3, CT (CBR3, Carbonyl reductase [NADPH] 3, NADPH-dependent carbonyl reductase 3) (AP) discontinued

Sign In for Pricing
View Details