Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPE1 Rabbit Polyclonal Antibody (FITC)

MPPE1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cdc1, PGAP5

UniProt

Q53F39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MPPE1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MFSD9 sgRNA gene knockout kit - Lentiviral human MFSD9 sgRNA gene knockout kit (25)
GTR15365586 1 Vial

Lentiviral human MFSD9 sgRNA gene knockout kit - Lentiviral human MFSD9 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
(Ser(Ac)³)-Ghrelin (mouse, rat)
4095528.1 1 mg

(Ser(Ac)³)-Ghrelin (mouse, rat)

Sign In for Pricing
View Details
PCMV-STUB1-GST-Neo Plasmid
PVT80909 2 µg

PCMV-STUB1-GST-Neo Plasmid

Sign In for Pricing
View Details
Ccnl2 (Cyclin-L2, Ccnl2) (PE) discontinued
302333-PE 200 µL

Ccnl2 (Cyclin-L2, Ccnl2) (PE) discontinued

Sign In for Pricing
View Details
NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2), MADER, MGC75085) (AP)
MBS6451256-01 0.1 mL

NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2), MADER, MGC75085) (AP)

Sign In for Pricing
View Details
NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2), MADER, MGC75085) (AP)
MBS6451256-02 5x 0.1 mL

NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2), MADER, MGC75085) (AP)

Sign In for Pricing
View Details