Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPE1 Rabbit Polyclonal Antibody (HRP)

MPPE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cdc1, PGAP5

UniProt

Q53F39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MPPE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CXCL16/SR-PSOX Protein
RP00584 50 µg

Recombinant Mouse CXCL16/SR-PSOX Protein

Sign In for Pricing
View Details
NHEJ1 Recombinant Antibody, PerCP Conjugated
bsm-62071R-PerCP-TR 20 µL

NHEJ1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Rabbit Intestinal Stem Cells
AFG-ELL-2269 > 5x 10^5 Cells / Vial

Rabbit Intestinal Stem Cells

Sign In for Pricing
View Details
Monoclonal Antibody to Glyoxalase I (GLO1)
TRV-0060931-01 20 µL

Monoclonal Antibody to Glyoxalase I (GLO1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glyoxalase I (GLO1)
TRV-0060931-02 100 µL

Monoclonal Antibody to Glyoxalase I (GLO1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glyoxalase I (GLO1)
TRV-0060931-03 200 µL

Monoclonal Antibody to Glyoxalase I (GLO1)

Sign In for Pricing
View Details