Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F12 Rabbit Polyclonal Antibody (HRP)

CYP4F12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYPIVF12, F22329_1

UniProt

Q9HCS2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP4F12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076433

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SART3 Protein
E30P7712 20 µg

Recombinant Human SART3 Protein

Sign In for Pricing
View Details
Spata7 (NM_178914) Mouse Tagged ORF Clone Lentiviral Particle
MR209112L4V 200 µL

Spata7 (NM_178914) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human Kelch-Like 3 Protein - (Dry Ice)
H00026249-P01-10ug 10 µg

Recombinant Human Kelch-Like 3 Protein - (Dry Ice)

Sign In for Pricing
View Details
RoboRocker 214
RR214-PL2.J 1 Each

RoboRocker 214

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH (ampH)
MBS1058247-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH (ampH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH (ampH)
MBS1058247-02 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH (ampH)

Sign In for Pricing
View Details