Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDAP1L1 Rabbit Polyclonal Antibody (HRP)

GDAP1L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DJ881L22.1, dJ995J12.1.1

UniProt

Q96MZ0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GDAP1L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Tropomyosin beta chain, TPM2 ELISA KIT
ELI-28451b 96 Tests

Bovine Tropomyosin beta chain, TPM2 ELISA KIT

Sign In for Pricing
View Details
JIK/TAOK3 Rabbit Polyclonal Antibody (HRP)
orb472538 100 µL

JIK/TAOK3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
RECQL5 sgRNA CRISPR Lentivector (Human) (Target 2)
K1806403 1.0 µg DNA

RECQL5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
(2-Phenylcyclopropyl) methanol
LCA82640-01 250 mg

(2-Phenylcyclopropyl) methanol

Sign In for Pricing
View Details
(2-Phenylcyclopropyl) methanol
LCA82640-02 2.5 g

(2-Phenylcyclopropyl) methanol

Sign In for Pricing
View Details
AE binding protein 1 (AEBP1) (NM_001129) Human Tagged Lenti ORF Clone
RC207782L2 10 µg

AE binding protein 1 (AEBP1) (NM_001129) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details