Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrg4 Rabbit Polyclonal Antibody (FITC)

Prrg4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TMG4, 9930111I18Rik

UniProt

Q8BGN6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CIRSLKDSEHAPEEVFASKEAANIFMHRRLLNNRFDLELFTPGDLERECY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmc2a Antibody
orb861700 2 mg

Tmc2a Antibody

Sign In for Pricing
View Details
CA6 (NM_001215) Human Over-expression Lysate
LS000765 100 µg

CA6 (NM_001215) Human Over-expression Lysate

Sign In for Pricing
View Details
Ppp1r2, ID (Ppp1r2, Ipp2, Protein phosphatase inhibitor 2) (MaxLight 490) discontinued
040343-ML490 100 µL

Ppp1r2, ID (Ppp1r2, Ipp2, Protein phosphatase inhibitor 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA replication and repair protein recF (recF)
MBS1084705-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis DNA replication and repair protein recF (recF)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA replication and repair protein recF (recF)
MBS1084705-02 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis DNA replication and repair protein recF (recF)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA replication and repair protein recF (recF)
MBS1084705-03 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis DNA replication and repair protein recF (recF)

Sign In for Pricing
View Details