Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrg3 Rabbit Polyclonal Antibody (HRP)

Prrg3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm368

UniProt

Q6PAQ9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAVFLEAKNAHAVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074604

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2441), Biotin conjugate, 0.1mg/mL
BNCB2441-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2441), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF568 conjugate, 0.1mg/mL
BNC680901-500 1x 500 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHB) (NM_001018080) Human Recombinant Protein
TP314616L 1 mg

FSH beta (FSHB) (NM_001018080) Human Recombinant Protein

Sign In for Pricing
View Details
Human MCP-1 ELISA Kit, 1 x 96-well (pre-coated)
EA101855 1x 96 Well (Pre-Coated)

Human MCP-1 ELISA Kit, 1 x 96-well (pre-coated)

Sign In for Pricing
View Details
GYPB Rabbit Polyclonal Antibody
TA376888 100 µL

GYPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARL5A (NM_012097) Human Recombinant Protein
TP315504 20 µg

ARL5A (NM_012097) Human Recombinant Protein

Sign In for Pricing
View Details