Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG12 Rabbit Polyclonal Antibody (Biotin)

ALG12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDG1G, ECM39, hALG12, PP14673

UniProt

Q9BV10

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALG12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS29 (NM_057180) Human Tagged ORF Clone
RG201460 10 µg

VPS29 (NM_057180) Human Tagged ORF Clone

Sign In for Pricing
View Details
Respiratory Syncytial Virus (RSV) Antibody
abx022184 1 mg

Respiratory Syncytial Virus (RSV) Antibody

Sign In for Pricing
View Details
SAR405 R enantiomer 5mg
A21410-5 5 mg

SAR405 R enantiomer 5mg

Sign In for Pricing
View Details
GLRB (NM_001166060) Human Tagged Lenti ORF Clone
RC228928L2 10 µg

GLRB (NM_001166060) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PRKAG2 ORF Vector (Human) (pORF)
ORF008202 1.0 µg DNA

PRKAG2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
p53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53, TRP53, Tumor Protein p53, Tumor Suppressor p53) (BSA & Azide Free) (MaxLight 750)
MBS6236724-01 0.1 mL

p53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53, TRP53, Tumor Protein p53, Tumor Suppressor p53) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details