Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RETREG2 Rabbit Polyclonal Antibody (FITC)

RETREG2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MAG-2, C2orf17, FAM134A

UniProt

Q8NC44

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM134A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077269

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (Dimethylphosphoryl) pyridine-3-carboxylic acid hydrochloride
CWD82921-01 50 mg

5- (Dimethylphosphoryl) pyridine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
5- (Dimethylphosphoryl) pyridine-3-carboxylic acid hydrochloride
CWD82921-02 0.5 g

5- (Dimethylphosphoryl) pyridine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
CXorf20 Peptide - middle region (AAP53162)
AAP53162-100UG 100 µg

CXorf20 Peptide - middle region (AAP53162)

Sign In for Pricing
View Details
MFGE8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated
PH50890I9-01 20 µg

MFGE8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated

Sign In for Pricing
View Details
MFGE8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated
PH50890I9-02 100 µg

MFGE8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated

Sign In for Pricing
View Details
DNA Ligase III (LIG3) (NM_013975) Human Over-expression Lysate
LY415562 100 µg

DNA Ligase III (LIG3) (NM_013975) Human Over-expression Lysate

Sign In for Pricing
View Details