Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGC4172 Rabbit Polyclonal Antibody (FITC)

MGC4172 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARPG836, SDR24C1, spDHRS11

UniProt

Q6UWP2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MGC4172

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAG33637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anterior Gradient 2 Rabbit Polyclonal Antibody (BF555)
orb2413398 100 µL

Anterior Gradient 2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Anti-RED1/ADARB1 Antibody Picoband®, APC Conjugate
A01810-2-APC 100 µg/Vial

Anti-RED1/ADARB1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Mouse Pappa2 Pre-designed siRNA Set A
SI110100A 1 Each

Mouse Pappa2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Protein fem-1 homolog C, FEM1C ELISA KIT
ELI-48472h 96 Tests

Human Protein fem-1 homolog C, FEM1C ELISA KIT

Sign In for Pricing
View Details
Canine Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 ELISA Kit
MBS063584-01 48 Well

Canine Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 ELISA Kit

Sign In for Pricing
View Details
Canine Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 ELISA Kit
MBS063584-02 96 Well

Canine Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 ELISA Kit

Sign In for Pricing
View Details