Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGC4172 Rabbit Polyclonal Antibody (HRP)

MGC4172 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARPG836, SDR24C1, spDHRS11

UniProt

Q6UWP2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MGC4172

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAG33637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11B3]
TA813201AM 100 µL

CD40 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11B3]

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI20D1]
TA804713AM 100 µL

MDM2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI20D1]

Sign In for Pricing
View Details
Recombinant EIF4E (phospho S209) Antibody
RC-4520-01 50 μL

Recombinant EIF4E (phospho S209) Antibody

Sign In for Pricing
View Details
Recombinant EIF4E (phospho S209) Antibody
RC-4520-02 100 µL

Recombinant EIF4E (phospho S209) Antibody

Sign In for Pricing
View Details
Recombinant EIF4E (phospho S209) Antibody
RC-4520-03 1 mL

Recombinant EIF4E (phospho S209) Antibody

Sign In for Pricing
View Details
TCF3 / E2A (TCF3) Rabbit Polyclonal Antibody
AP20520PU-N 100 µg

TCF3 / E2A (TCF3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details