Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNPTAB Rabbit Polyclonal Antibody (HRP)

GNPTAB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ICD, GNPTA

UniProt

Q3T906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNPTAB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia pestis bv. Antiqua Cation-efflux pump FieF (fieF), partial
MBS7074296 Inquire

Recombinant Yersinia pestis bv. Antiqua Cation-efflux pump FieF (fieF), partial

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
MBS454100-01 48 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
MBS454100-02 96 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
MBS454100-03 5x 96 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
MBS454100-04 10x 96 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
GLI1 Monoclonal Antibody
BT-MCA4253-01 50 µL

GLI1 Monoclonal Antibody

Sign In for Pricing
View Details