Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH3 Rabbit Polyclonal Antibody (Biotin)

ARMH3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C10orf76

UniProt

Q5T2E6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CJ076

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELVRSISTNVRRNLAFH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-4-[2- (dimethylamino) ethoxy]benzaldehyde
424272-01 100 mg

3-Bromo-4-[2- (dimethylamino) ethoxy]benzaldehyde

Sign In for Pricing
View Details
3-Bromo-4-[2- (dimethylamino) ethoxy]benzaldehyde
424272-02 250 mg

3-Bromo-4-[2- (dimethylamino) ethoxy]benzaldehyde

Sign In for Pricing
View Details
4930504E06Rik (BC093521) Mouse Tagged ORF Clone
MG204163 10 µg

4930504E06Rik (BC093521) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal PDLIM4 Antibody [Alexa Fluor 532]
NBP2-98063AF532 0.1 mL

Rabbit Polyclonal PDLIM4 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)
MBS6121360-01 0.2 mL

HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)

Sign In for Pricing
View Details
HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)
MBS6121360-02 5x 0.2 mL

HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)

Sign In for Pricing
View Details