Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MANEA Rabbit Polyclonal Antibody (HRP)

MANEA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ENDO, hEndo

UniProt

Q5SRI9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MANEA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL18R1 Antibody (013) [Alexa Fluor 647]
NBP2-90418AF647 0.1 mL

Rabbit Monoclonal IL18R1 Antibody (013) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human ACE (Angiotensin I Converting Enzyme) ELISA Kit
MBS8800002-01 48 Well

Human ACE (Angiotensin I Converting Enzyme) ELISA Kit

Sign In for Pricing
View Details
Human ACE (Angiotensin I Converting Enzyme) ELISA Kit
MBS8800002-02 96 Well

Human ACE (Angiotensin I Converting Enzyme) ELISA Kit

Sign In for Pricing
View Details
Human ACE (Angiotensin I Converting Enzyme) ELISA Kit
MBS8800002-03 5x 96 Well

Human ACE (Angiotensin I Converting Enzyme) ELISA Kit

Sign In for Pricing
View Details
Human ACE (Angiotensin I Converting Enzyme) ELISA Kit
MBS8800002-04 10x 96 Well

Human ACE (Angiotensin I Converting Enzyme) ELISA Kit

Sign In for Pricing
View Details
Japanese Acid Clay
19725-95 500 g

Japanese Acid Clay

Sign In for Pricing
View Details