Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1305007 Rabbit Polyclonal Antibody (Biotin)

RGD1305007 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1305007

UniProt

Q5M843

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1305007

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFEGCTPRKCGRGVTDIVITREEAEQIRRIAEKGLSLGGSDGGASILDLH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013998

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCK antibody
10R-10823 100 ug

LCK antibody

Sign In for Pricing
View Details
BCL2L1, Phosphorylated (S62) (Bcl-2-like protein 1, BCLX, BCL2L, BCLXL, BCLXS, Bcl-X, bcl-xL, bcl-xS, PPP1R52, BCL-XL/S) (MaxLight 550)
MBS6408364-01 0.1 mL

BCL2L1, Phosphorylated (S62) (Bcl-2-like protein 1, BCLX, BCL2L, BCLXL, BCLXS, Bcl-X, bcl-xL, bcl-xS, PPP1R52, BCL-XL/S) (MaxLight 550)

Sign In for Pricing
View Details
BCL2L1, Phosphorylated (S62) (Bcl-2-like protein 1, BCLX, BCL2L, BCLXL, BCLXS, Bcl-X, bcl-xL, bcl-xS, PPP1R52, BCL-XL/S) (MaxLight 550)
MBS6408364-02 5x 0.1 mL

BCL2L1, Phosphorylated (S62) (Bcl-2-like protein 1, BCLX, BCL2L, BCLXL, BCLXS, Bcl-X, bcl-xL, bcl-xS, PPP1R52, BCL-XL/S) (MaxLight 550)

Sign In for Pricing
View Details
Gsr sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4916206 1.0 µg DNA

Gsr sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SPG21 Protein Vector (Rat) (pPB-C-His)
PV307714 500 ng

SPG21 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Claudin 10 Rabbit Polyclonal Antibody (BF555)
orb2521852 100 µL

Claudin 10 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details