Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC15 Rabbit Polyclonal Antibody (FITC)

TXNDC15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BUG, UNQ335, C5orf14

UniProt

Q96J42

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TXNDC15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat cross linked N-telopeptide of type I collagen, NTX ELISA Kit
NB-E30159 96 Well

Rat cross linked N-telopeptide of type I collagen, NTX ELISA Kit

Sign In for Pricing
View Details
Rat VEGFR3 ELISA Kit (Ready to Use)
orb555663-01 48 Tests

Rat VEGFR3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rat VEGFR3 ELISA Kit (Ready to Use)
orb555663-02 96 Tests

Rat VEGFR3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
DHH Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV668639 1.0 µg DNA

DHH Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Vacuolar cation/proton exchanger 2 (CAX2), partial
MBS7083441 Inquire

Recombinant Oryza sativa subsp. japonica Vacuolar cation/proton exchanger 2 (CAX2), partial

Sign In for Pricing
View Details
Uridine- 2', 3'- cyclic monophosphate (2',3'-cUMP), sodium salt
U 004-250 5x 50 µmol

Uridine- 2', 3'- cyclic monophosphate (2',3'-cUMP), sodium salt

Sign In for Pricing
View Details