Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC15 Rabbit Polyclonal Antibody (HRP)

TXNDC15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BUG, UNQ335, C5orf14

UniProt

Q96J42

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TXNDC15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPM2A Human qPCR Primer Pair (NM_005670)
HP232754 200 Reactions

EPM2A Human qPCR Primer Pair (NM_005670)

Sign In for Pricing
View Details
Colloidal Gold Labeled Neomycin HRP, 1mL 40nm
GH-02-40 1 mL

Colloidal Gold Labeled Neomycin HRP, 1mL 40nm

Sign In for Pricing
View Details
KHK Antibody
KC-597-01 50 μL

KHK Antibody

Sign In for Pricing
View Details
KHK Antibody
KC-597-02 100 µL

KHK Antibody

Sign In for Pricing
View Details
KHK Antibody
KC-597-03 1 mL

KHK Antibody

Sign In for Pricing
View Details
alpha Glucosidase II (GANAB) Human Gene Knockout Kit (CRISPR)
KN418899 1 Kit

alpha Glucosidase II (GANAB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details