Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf49 Rabbit Polyclonal Antibody (Biotin)

C12orf49 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LUR1, POST1, SPRING, C12orf49

UniProt

Q9H741

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf49

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LONRF3 Human siRNA Oligo Duplex (Locus ID 79836)
SR312637 1 Kit

LONRF3 Human siRNA Oligo Duplex (Locus ID 79836)

Sign In for Pricing
View Details
GRIK2 antibody - N-terminal region (ARP35340_T100)
ARP35340_T100 100 µL

GRIK2 antibody - N-terminal region (ARP35340_T100)

Sign In for Pricing
View Details
Somatostatin (HRP) discontinued
S5331-12-HRP 100 µL

Somatostatin (HRP) discontinued

Sign In for Pricing
View Details
Mouse TIMP-2 DuoSet ELISA 5 Plate
DY6304-05 5 Plates

Mouse TIMP-2 DuoSet ELISA 5 Plate

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 164 (C2orf39) ELISA Kit
MBS7247308-01 48 Well

Human Coiled coil domain containing protein 164 (C2orf39) ELISA Kit

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 164 (C2orf39) ELISA Kit
MBS7247308-02 96 Well

Human Coiled coil domain containing protein 164 (C2orf39) ELISA Kit

Sign In for Pricing
View Details