Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf49 Rabbit Polyclonal Antibody (HRP)

C12orf49 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LUR1, POST1, SPRING, C12orf49

UniProt

Q9H741

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C12orf49

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP6 Rabbit Polyclonal Antibody (Cy7)
orb1064164 100 µL

CTRP6 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
12-Strip Domed Caps, 80 Strips of 12 Caps
GP410 960 Caps

12-Strip Domed Caps, 80 Strips of 12 Caps

Sign In for Pricing
View Details
Recombinant Human RAC2 Protein, Untagged, E.coli-5ug
QP13250-5ug 5ug

Recombinant Human RAC2 Protein, Untagged, E.coli-5ug

Sign In for Pricing
View Details
MAPKAPK2 Antibody Blocking peptide
orb1446868 500 µg

MAPKAPK2 Antibody Blocking peptide

Sign In for Pricing
View Details
Adam24 Protein Vector (Mouse) (pPM-C-HA)
PV152292 500 ng

Adam24 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Vitamin D3 receptor Recombinant Antibody
bsm-61452R-TR 20 µL

Vitamin D3 receptor Recombinant Antibody

Sign In for Pricing
View Details