Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT2A3 Rabbit Polyclonal Antibody (HRP)

UGT2A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ21934

UniProt

Q6UWM9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UGT2A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_079019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
MBS2502637-01 24 Tests

Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
MBS2502637-02 48 Tests

Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
MBS2502637-03 96 Tests

Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
MBS2502637-04 5x 96 Tests

Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
MBS2502637-05 10x 96 Tests

Monkey VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
TROP-2 Rabbit pAb
E45R30130N-100 100 µL

TROP-2 Rabbit pAb

Sign In for Pricing
View Details