Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT2A3 Rabbit Polyclonal Antibody (HRP)

UGT2A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ21934

UniProt

Q6UWM9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UGT2A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_079019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit
MBS9925671-01 48 Well

Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit

Sign In for Pricing
View Details
Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit
MBS9925671-02 96 Well

Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit

Sign In for Pricing
View Details
Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit
MBS9925671-03 5x 96 Well

Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit

Sign In for Pricing
View Details
Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit
MBS9925671-04 10x 96 Well

Rat Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit

Sign In for Pricing
View Details
Umod siRNA Oligos set (Mouse)
49169174 3x 5 nmol

Umod siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Reagecon Sodium Hydroxide 0.25M (0.25N) Analytical Volumetric Solution (AVL)
S20255 5 L

Reagecon Sodium Hydroxide 0.25M (0.25N) Analytical Volumetric Solution (AVL)

Sign In for Pricing
View Details